PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000520807
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 581aa    MW: 66249.2 Da    PI: 5.4121
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000520807genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.42.2e-5661331128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    lppGfrFhPtdeelv +yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s
  MDP0000520807   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS 100
                    79****************************.99***************6434555777************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+kktLv+y grap+g++tdWvmheyrl
  MDP0000520807 101 -QTRAVGMKKTLVYYGGRAPHGSRTDWVMHEYRL 133
                    .9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-604138IPR003441NAC domain
PROSITE profilePS5100556.7946153IPR003441NAC domain
PfamPF023652.8E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEVIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QTRAVGMKKT LVYYGGRAPH  120
GSRTDWVMHE YRLDERECET AQGLQVQVDI ALECARLQHR LSLPPLEVED FSQVGLTDFK  180
TMQYSNPAPD TTSXETDALQ EILSVAHVSQ EMINQSSNLV DQTWGGNYAP PANDFSFMVD  240
RDAQYNQITD HMNSMRYVDH KTWGNSYTRS IEIGDLEDGF RMENTAENLR WIGMSDKDLE  300
KSFTEEHKIV PIENISSFRR EEQEQQYEIQ DSIAGETGHH SGIIKELNDN EANXDDFSLS  360
FINEDPNENF LHDGNMDDYS PSPSFEVIEE IQVNHGMFVS TRQVAETFFH QLMPSQTVKV  420
HLNPVLGQNF FIERVVTQKK SEDRGSFFKR XKELVMEXFD GIAKSXXPWG KIASTLVCAV  480
TLILMHMIIY LGQHMEDEKL MDAFTRTTTA TSVEENGSSE ISNKKKGLGL IKWSNKKEKV  540
CLVNVRGGNS CSVFLKKMGI FLTVSLALGT MWANHNIISP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-56213311140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008343142.10.0PREDICTED: uncharacterized protein LOC103405896 isoform X1
RefseqXP_008343143.10.0PREDICTED: uncharacterized protein LOC103405896 isoform X2
TrEMBLM5XAW60.0M5XAW6_PRUPE; Uncharacterized protein
STRINGVIT_04s0079g00280.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.19e-97NAC domain containing protein 45